| 产品详情 |
| Edit |   |
| Antigenic Specificity | Indoleamine 2,3-dioxygenase/IDO |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Indoleamine 2,3-dioxygenase/IDO Antibody from Novus Biologicals is a rabbit polyclonal antibody to Indoleamine 2,3-dioxygenase/IDO. This antibody reacts with human. The Indoleamine 2,3-dioxygenase/IDO Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Indoleamine 2,3-dioxygenase/IDO antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LCSLESNPSVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQQPKENKTSEDPSKLEAKGTGGTDLMNFLK |
| Other Names | EC 1.13.11.52, IDOIDO-1, INDOindole 2,3-dioxygenase, indoleamine 2,3-dioxygenase 1, indoleamine-pyrrole 2,3 dioxygenase, Indoleamine-pyrrole 2,3-dioxygenase |
| Gene, Accession # | IDO1, Gene ID: 3620, Accession: P14902, SwissProt: P14902 |
| Catalog # | NBP1-87702 |
| Price | |
| Order / More Info | Indoleamine 2,3-dioxygenase/IDO Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 26092774, 27151136, 29667084 |
| 产品资料 |
|
|