| Edit |   |
| Antigenic Specificity | ACPL2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ACPL2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACPL2. This antibody reacts with human. The ACPL2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to ACPL2(acid phosphatase-like 2) The peptide sequence was selected from the middle region of ACPL2. Peptide sequence SFESPLNSLPLYPNHPLCEMGELTQTGVVQHLQNGQLLRDIYLKKHKLLP. |
| Other Names | acid phosphatase-like 2, acid phosphatase-like protein 2, EC 3.1.3.2, FLJ23751 |
| Gene, Accession # | ACPL2, Gene ID: 92370, Accession: Q8TE99, SwissProt: Q8TE99 |
| Catalog # | NBP1-59508-20ul |
| Price | |
| Order / More Info | ACPL2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |