| Edit |   |
|---|
| Antigenic Specificity | ACPL2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ACPL2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACPL2. This antibody reacts with human. The ACPL2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ACPL2(acid phosphatase-like 2) The peptide sequence was selected from the N terminal of ACPL2. Peptide sequence PSVAERSMEGHAPHHFKLVSVHVFIRHGDRYPLYVIPKTKRPEIDCTLVA. |
|---|
| Other Names | acid phosphatase-like 2, acid phosphatase-like protein 2, EC 3.1.3.2, FLJ23751 |
|---|
| Gene, Accession # | ACPL2, Gene ID: 92370, Accession: Q8TE99, SwissProt: Q8TE99 |
|---|
| Catalog # | NBP1-59507-20ul |
|---|
| Price | |
|---|
| Order / More Info | ACPL2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|