| Edit |   |
| Antigenic Specificity | ACOXL |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ACOXL Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACOXL. This antibody reacts with human. The ACOXL Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ACOXL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RSLVIGEVLSMADMATGVKCGIIYWLFGGAIRNLGSPEHVTKWFQPLQEQKYTGMFAMTERGHGSNARGIQTEATFDLSAQEFVIDTPCENAEKMY |
| Other Names | Acyl-CoA Oxidase-Like, Acyl-CoA Oxidase-Like Protein, Acyl-Coenzyme A Oxidase-Like, Acyl-Coenzyme A Oxidase-Like Protein |
| Gene, Accession # | ACOXL, Gene ID: 55289, Accession: Q9NUZ1, SwissProt: Q9NUZ1 |
| Catalog # | NBP2-34002 |
| Price | |
| Order / More Info | ACOXL Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 26237329 |