| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ACOT7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ACOT7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACOT7. This antibody reacts with human. The ACOT7 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ACOT7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITGRIMRPDDANVAGNVHGGTILKMIEEAGAIISTRHCNSQNGE |
|---|
| Other Names | ACH1, acyl-CoA thioesterase 7CTE-IIa, BACHEC 3.1.2.2, brain acyl CoA hydrolase, Brain acyl-CoA hydrolase, CTE-IILACH, cytosolic acyl coenzyme A thioester hydrolase, hBACH, long chain, Long chain acyl-CoA thioester hydrolase |
|---|
| Gene, Accession # | ACOT7, Gene ID: 11332, Accession: O00154, SwissProt: O00154 |
|---|
| Catalog # | NBP1-89278 |
|---|
| Price | |
|---|
| Order / More Info | ACOT7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|