| 产品详情 |
| Edit |   |
| Antigenic Specificity | Inorganic Pyrophosphatase/PPA1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Inorganic Pyrophosphatase/PPA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Inorganic Pyrophosphatase/PPA1. This antibody reacts with human, mouse, rat. The Inorganic Pyrophosphatase/PPA1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat Inorganic Pyrophosphatase/PPA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAK |
| Other Names | diphosphate phosphohydrolase, EC 3.6.1.1, inorganic diphosphatase, inorganic pyrophosphatase, inorganic pyrophosphatase 1, IOPPPMGC111556, PP1, PPase, PPcytosolic inorganic pyrophosphatase, pyrophosphatase (inorganic), pyrophosphatase (inorganic) 1, pyrophosphatase 1, Pyrophosphate phospho-hydrolase, SID6-8061 |
| Gene, Accession # | PPA1, Gene ID: 5464 |
| Catalog # | NBP1-87788 |
| Price | |
| Order / More Info | Inorganic Pyrophosphatase/PPA1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|