| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Adiponectin/Acrp30 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Adiponectin/Acrp30 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Adiponectin/Acrp30. This antibody reacts with human. The Adiponectin/Acrp30 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Adiponectin/Acrp30 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFL |
|---|
| Other Names | ACDC, ACRP30ADPN, adipocyte, C1Q and collagen domain containing, adiponectin, adiponectin, C1Q and collagen domain containing, AdipoQ, ADIPQTL1, apM-1, APM1APM-1, C1q and collagen domain-containing protein, GBP28apM1, Gelatin-binding protein |
|---|
| Gene, Accession # | ADIPOQ, Gene ID: 9370, Accession: Q15848, SwissProt: Q15848 |
|---|
| Catalog # | NBP2-38657 |
|---|
| Price | |
|---|
| Order / More Info | Adiponectin/Acrp30 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|