| 产品详情 |
| Edit |   |
| Antigenic Specificity | ACADSB |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ACADSB Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACADSB. This antibody reacts with human. The ACADSB Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ACADSB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EASMAKYYASEIAGQTTSKCIEWMGGVGYTKDYPVEKYFRDAKIGTIYEGASNIQLNTIAKHIDAE |
| Other Names | 2-MEBCAD, 2-methylbutyryl-coenzyme A dehydrogenase, ACAD7,2-methylbutyryl-CoA dehydrogenase, acyl-CoA dehydrogenase, short/branched chain, acyl-Coenzyme A dehydrogenase, short/branched chain, EC 1.3.99,2-methyl branched chain acyl-CoA dehydrogenase, EC 1.3.99.-, SBCADshort/branched chain specific acyl-CoA dehydrogenase, mitochondrial |
| Gene, Accession # | ACADSB, Gene ID: 36 |
| Catalog # | NBP2-48739 |
| Price | |
| Order / More Info | ACADSB Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|