| 产品详情 |
| Edit |   |
| Antigenic Specificity | ACAD11 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ACAD11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACAD11. This antibody reacts with human. The ACAD11 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ACAD11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FSLFYFWPRTVPMINQGSYSENSGIPSMEELISIYCRCRGINSILPNWNF FLALSYFKMAGIAQGVYSRYLLGNNSSEDSFLFANIVQPL |
| Other Names | ACAD-11, acyl-CoA dehydrogenase family member 11, acyl-CoA dehydrogenase family, member 11, acyl-Coenzyme A dehydrogenase family, member 11, EC 1.3.99.-, FLJ12592, MGC150619 |
| Gene, Accession # | ACAD11, Gene ID: 84129, Accession: Q709F0, SwissProt: Q709F0 |
| Catalog # | NBP2-14255 |
| Price | |
| Order / More Info | ACAD11 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|