| 产品详情 |
| Edit |   |
| Antigenic Specificity | RALY |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RALY Antibody from Novus Biologicals is a rabbit polyclonal antibody to RALY. This antibody reacts with human. The RALY Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human RALY antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RLFDYRGRLSPVPVPRAVPVKRPRVTVPLVRRVKTNVPVKLFARSTAVTT SSAKIKLKSSELQAIK |
| Other Names | Autoantigen p542, Heterogeneous nuclear ribonucleoprotein C-like 2, hnRNP associated with lethal yellow protein homolog, hnRNP core protein C-like 2, HNRPCL2MGC117312, P542hnRNP-associated with lethal yellow), RNA binding protein (autoantigenic, hnRNP-associated with lethal yellow), RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog(mouse)), RNA-binding protein (autoantigenic), RNA-binding protein Raly |
| Gene, Accession # | RALY, Gene ID: 22913 |
| Catalog # | NBP2-13201 |
| Price | |
| Order / More Info | RALY Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|