| 产品详情 |
| Edit |   |
| Antigenic Specificity | RALGAPA2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RALGAPA2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RALGAPA2. This antibody reacts with human. The RALGAPA2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human RALGAPA2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SPAELDLKDDLQQTQGKCRERQKSESTNSDTTLGCTNEAELSMGPWQTCEEDPELNTPTDVVADADARHWLQLSPTDA |
| Other Names | AS250KIAA1272akt substrate AS250, bA287B20.1, C20orf74, chromosome 20 open reading frame 74, dJ1049G11,250 kDa substrate of Akt, dJ1049G11.4, EC 2.7.2.11, EC 5.3.4.1, FLJ12819, p220, Ral GTPase activating protein, alpha subunit 2 (catalytic), ral GTPase-activating protein alpha subunit 2, ral GTPase-activating protein subunit alpha-2, RapGAPalpha2 |
| Gene, Accession # | RALGAPA2, Gene ID: 57186, Accession: Q2PPJ7, SwissProt: Q2PPJ7 |
| Catalog # | NBP2-33399 |
| Price | |
| Order / More Info | RALGAPA2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|