| Edit |   |
| Antigenic Specificity | RalA/RalB |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RalA/RalB Antibody from Novus Biologicals is a rabbit polyclonal antibody to RalA/RalB. This antibody reacts with human. The RalA/RalB Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
| Immunogen | Synthetic peptide directed towards the middle region of human RALAThe immunogen for this antibody is RALA. Peptide sequence GQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV. |
| Other Names | MGC48949, RAL, Ras family small GTP binding protein RALA, RAS-like protein A, ras-related protein Ral-A, v-ral simian leukemia viral oncogene homolog A (ras related) |
| Gene, Accession # | RALA, Gene ID: 5898, Accession: NP_005393, SwissProt: NP_005393 |
| Catalog # | NBP1-79633 |
| Price | |
| Order / More Info | RalA/RalB Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |