| Edit |   |
| Antigenic Specificity | TTC23L |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TTC23L Antibody from Novus Biologicals is a rabbit polyclonal antibody to TTC23L. This antibody reacts with human. The TTC23L Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to FLJ25439 The peptide sequence was selected from the N terminal of FLJ25439. Peptide sequence MQASPIRIPTVSNDIDWDFCFHMSQQTEIPAHQQTDELYPTGGCGESEEE. |
| Other Names | FLJ25439, tetratricopeptide repeat domain 23-like, tetratricopeptide repeat protein 23-like |
| Gene, Accession # | TTC23L, Gene ID: 153657, Accession: Q6PF05, SwissProt: Q6PF05 |
| Catalog # | NBP1-57634 |
| Price | |
| Order / More Info | TTC23L Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |