| Edit |   |
|---|
| Antigenic Specificity | TTC8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TTC8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TTC8. This antibody reacts with human. The TTC8 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TTC8(tetratricopeptide repeat domain 8) The peptide sequence was selected from the N terminal of TTC8. Peptide sequence ENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSG. |
|---|
| Other Names | Bardet-Biedl syndrome 8 protein, BBS8Bardet-Biedl syndrome type 8, RP51, tetratricopeptide repeat domain 8, tetratricopeptide repeat protein 8, TPR repeat protein 8 |
|---|
| Gene, Accession # | TTC8, Gene ID: 123016, Accession: Q8TAM2-3, SwissProt: Q8TAM2-3 |
|---|
| Catalog # | NBP1-55108-20ul |
|---|
| Price | |
|---|
| Order / More Info | TTC8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|