| Edit |   |
| Antigenic Specificity | TATA Element Modulatory Factor 1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TATA Element Modulatory Factor 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TATA Element Modulatory Factor 1. This antibody reacts with human. The TATA Element Modulatory Factor 1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human TMF1. Peptide sequence TPETTESQVKDSSLCVSGETLAAGTSSPKTEGKHEETVNKESDMKVPTVS. |
| Other Names | TATA element modulatory factor 1 |
| Gene, Accession # | TMF1, Gene ID: 7110, Accession: NP_009045, SwissProt: NP_009045 |
| Catalog # | NBP1-79708-20ul |
| Price | |
| Order / More Info | TATA Element Modulatory Factor 1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |