| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | alpha-Aminoadipate Aminotransferase |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The alpha-Aminoadipate Aminotransferase Antibody from Novus Biologicals is a rabbit polyclonal antibody to alpha-Aminoadipate Aminotransferase. This antibody reacts with human. The alpha-Aminoadipate Aminotransferase Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human alpha-Aminoadipate Aminotransferase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPD |
|---|
| Other Names | AadAT, aminoadipate aminotransferase, EC 2.6.1.39,2-aminoadipate aminotransferase, EC 2.6.1.7,2-aminoadipate transaminase, KAT/AadAT, KAT2mitochondrial, Kynurenine aminotransferase II, Kynurenine--oxoglutarate aminotransferase II, Kynurenine--oxoglutarate transaminase II, L kynurenine/alpha aminoadipate aminotransferase |
|---|
| Gene, Accession # | AADAT, Gene ID: 51166 |
|---|
| Catalog # | NBP1-89627 |
|---|
| Price | |
|---|
| Order / More Info | alpha-Aminoadipate Aminotransferase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|