| Edit |   |
|---|
| Antigenic Specificity | CCDC87 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCDC87 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC87. This antibody reacts with human. The CCDC87 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CCDC87(coiled-coil domain containing 87) The peptide sequence was selected from the N terminal of CCDC87. Peptide sequence MMEPPKPEPELQRFYHRLLRPLSLFPTRTTSPEPQKRPPQEGRILQSFPL. |
|---|
| Other Names | coiled-coil domain containing 87, coiled-coil domain-containing protein 87, FLJ10786 |
|---|
| Gene, Accession # | CCDC87, Gene ID: 55231, Accession: Q9NVE4, SwissProt: Q9NVE4 |
|---|
| Catalog # | NBP1-56880 |
|---|
| Price | |
|---|
| Order / More Info | CCDC87 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|