| Edit |   |
| Antigenic Specificity | CCDC78 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CCDC78 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC78. This antibody reacts with human. The CCDC78 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CCDC78(coiled-coil domain containing 78) The peptide sequence was selected from the middle region of CCDC78. Peptide sequence QELRHKAQVPGHSDDHRFQVQPKNTMDPENEQHRLGSGVSVQPPSSGERA. |
| Other Names | C16orf25, coiled-coil domain containing 78, coiled-coil domain-containing protein 78, FLJ34512, JFP10 |
| Gene, Accession # | CCDC78, Gene ID: 124093, Accession: A2IDD5, SwissProt: A2IDD5 |
| Catalog # | NBP1-55424 |
| Price | |
| Order / More Info | CCDC78 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |