| Edit |   |
| Antigenic Specificity | CCDC70 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CCDC70 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC70. This antibody reacts with human. The CCDC70 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CCDC70(coiled-coil domain containing 70) The peptide sequence was selected from the middle region of CCDC70. Peptide sequence TFRGKIHAFRGQILGFWEEERPFWEEEKTFWKEEKSFWEMEKSFREEEKT. |
| Other Names | coiled-coil domain containing 70, coiled-coil domain-containing protein 70, DKFZP434K1172, FLJ25853 |
| Gene, Accession # | CCDC70, Gene ID: 83446, Accession: Q6NSX1, SwissProt: Q6NSX1 |
| Catalog # | NBP1-55305 |
| Price | |
| Order / More Info | CCDC70 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |