| Edit |   |
|---|
| Antigenic Specificity | CCDC69 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCDC69 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC69. This antibody reacts with human. The CCDC69 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CCDC69(coiled-coil domain containing 69) The peptide sequence was selected from the middle region of CCDC69. Peptide sequence TREALEKEVQLRRQLQQEKEELLYRVLGANASPAFPLAPVTPTEVSFLAT. |
|---|
| Other Names | coiled-coil domain containing 69, coiled-coil domain-containing protein 69, DKFZP434C171, FLJ13705 |
|---|
| Gene, Accession # | CCDC69, Gene ID: 26112, Accession: A6NI79, SwissProt: A6NI79 |
|---|
| Catalog # | NBP1-56589 |
|---|
| Price | |
|---|
| Order / More Info | CCDC69 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|