| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CCDC68 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCDC68 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC68. This antibody reacts with human. The CCDC68 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CCDC68 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MTTVTVTTEIPPRDKMEDNSALYESTSAHIIEETEYVKKIRTTLQKIRTQMFKDEIRHDSTNHKLDAKHCGNLQQGSDSEMDPS |
|---|
| Other Names | coiled-coil domain containing 68, coiled-coil domain-containing protein 68, CTCL tumor antigen se57-1, CTCL-associated antigen se57-1, cutaneous T-cell lymphoma associated antigen, Cutaneous T-cell lymphoma-associated antigen se57-1, FLJ25368, SE57-1 |
|---|
| Gene, Accession # | CCDC68, Gene ID: 80323 |
|---|
| Catalog # | NBP2-47520 |
|---|
| Price | |
|---|
| Order / More Info | CCDC68 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|