| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Cystatin E/M/CST6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Cystatin E/M/CST6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cystatin E/M/CST6. This antibody reacts with human. The Cystatin E/M/CST6 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Cystatin E/M/CST6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKH |
|---|
| Other Names | cystatin 6, cystatin E/M, cystatin M, cystatin M/E, Cystatin-6, Cystatin-E, cystatin-M, cysteine proteinase inhibitor |
|---|
| Gene, Accession # | CST6, Gene ID: 1474, Accession: Q15828, SwissProt: Q15828 |
|---|
| Catalog # | NBP2-33433 |
|---|
| Price | |
|---|
| Order / More Info | Cystatin E/M/CST6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|