| Edit |   |
|---|
| Antigenic Specificity | CCNB3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCNB3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCNB3. This antibody reacts with human. The CCNB3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human CCNB3. Peptide sequence ISELHPLVRQLNKLLTFSSYDSLKAVYYKYSHPVFFEVAKIPALDMLKLE. |
|---|
| Other Names | CYCB3, cyclin B3, G2/mitotic-specific cyclin-B3 |
|---|
| Gene, Accession # | CCNB3, Gene ID: 85417, Accession: NP_149020, SwissProt: NP_149020 |
|---|
| Catalog # | NBP1-80384-20ul |
|---|
| Price | |
|---|
| Order / More Info | CCNB3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|