| Edit |   |
| Antigenic Specificity | CCM2L |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CCM2L Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCM2L. This antibody reacts with human. The CCM2L Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C20ORF160 The peptide sequence was selected from the N terminal of C20ORF160. Peptide sequence LTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSILSLSARCLLL. |
| Other Names | chromosome 20 open reading frame 160, dJ310O13.5 |
| Gene, Accession # | CCM2L, Gene ID: 140706 |
| Catalog # | NBP1-70461 |
| Price | |
| Order / More Info | CCM2L Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |