| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MYLIP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MYLIP Antibody from Novus Biologicals is a rabbit polyclonal antibody to MYLIP. This antibody reacts with human. The MYLIP Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MYLIP (myosin regulatory light chain interacting protein). The peptide sequence was selected from the middle region of MYLIP. Peptide sequence CSSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCE. |
|---|
| Other Names | band 4.1 superfamily member BZF1, BZF1, cellular modulator of immune recognition (c-MIR), EC 6.3.2.-, Idol, IDOLmyosin regulatory light chain-interacting protein, Inducible degrader of the LDL-receptor, MIRE3 ubiquitin-protein ligase MYLIP, myosin regulatory light chain interacting proteinE3 ubiquitin ligase-inducible degrader of the low density lipoprotein receptor |
|---|
| Gene, Accession # | MYLIP, Gene ID: 29116, Accession: Q8WY64, SwissProt: Q8WY64 |
|---|
| Catalog # | NBP1-54903 |
|---|
| Price | |
|---|
| Order / More Info | MYLIP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|