| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EMP/MAEA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EMP/MAEA Antibody from Novus Biologicals is a rabbit polyclonal antibody to EMP/MAEA. This antibody reacts with human. The EMP/MAEA Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human EMP/MAEA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GVVEKLSVLKRKAVESIQAEDESAKLCKRRIEHLKEHSSDQPAAASVWKRKRMDRMMVEHLLRCGYYNTAVKL |
|---|
| Other Names | EMLP, EMPCell proliferation-inducing gene 5 protein, Erythroblast macrophage protein, HLC-10, Human lung cancer oncogene 10 protein, lung cancer-related protein 10, macrophage erythroblast attacher, PIG5, proliferation-inducing gene 5 |
|---|
| Gene, Accession # | MAEA, Gene ID: 10296 |
|---|
| Catalog # | NBP2-55034 |
|---|
| Price | |
|---|
| Order / More Info | EMP/MAEA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|