| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EMP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. IHC, WB reported in scientific literature (PMID: 25940704). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. Western Blot verified by a customer review. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EMP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EMP2. This antibody reacts with human. The EMP2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human EMP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYST |
|---|
| Other Names | epithelial membrane protein 2, MGC9056, Protein XMP, XMPEMP-2 |
|---|
| Gene, Accession # | EMP2, Gene ID: 2013 |
|---|
| Catalog # | NBP1-86847 |
|---|
| Price | |
|---|
| Order / More Info | EMP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22492389, 24105764, 25940704 |
|---|
| 产品资料 |
|
|