| 产品详情 |
| Edit |   |
| Antigenic Specificity | PP14/Glycodelin |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PP14/Glycodelin Antibody from Novus Biologicals is a rabbit polyclonal antibody to PP14/Glycodelin. This antibody reacts with human. The PP14/Glycodelin Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PP14/Glycodelin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKI |
| Other Names | alpha uterine protein, GdF, GdS, glycodelin, glycodelin-A, glycodelin-F, glycodelin-S, MGC138509, MGC142288, PEP, Placental protein 14, PP14 protein (placental protein 14), PP14GDPAEGGdA, pregnancy-associated endometrial a, Pregnancy-associated endometrial alpha-2 globulin, pregnancy-associated endometrial alpha-2-globulin, progestagen-associated endometrial protein (placental protein 14, progestagen-associated endometrial proteinPEG, Progesterone-associated endometrial protein |
| Gene, Accession # | PAEP, Gene ID: 5047 |
| Catalog # | NBP1-89781 |
| Price | |
| Order / More Info | PP14/Glycodelin Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|