| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PPFIA4 |
|---|
| Clone | 3B1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PPFIA4 Antibody (3B1) from Novus Biologicals is a mouse monoclonal antibody to PPFIA4. This antibody reacts with human. The PPFIA4 Antibody (3B1) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | PPFIA4 (NP_055868 604 a.a. - 699 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RQVMEREFNNLLALGTDRKLDDGDDKVFRRAPSWRKRFRPREHHGRGGMLSASAETLPAGFRVSTLGTLQPPPAPPKKIMPEAHSHYLYGHMLSAF |
|---|
| Other Names | KIAA0897, liprin alpha4, liprin-alpha-4, Liprin-alpha4, Protein tyrosine phosphatase receptor type f polypeptide-interacting proteinalpha-4, protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interactingprotein (liprin), alpha 4, PTPRF-interacting protein alpha-4 |
|---|
| Gene, Accession # | PPFIA4, Gene ID: 8497, Accession: NP_055868, SwissProt: NP_055868 |
|---|
| Catalog # | H00008497-M10 |
|---|
| Price | |
|---|
| Order / More Info | PPFIA4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|