| 产品详情 |
| Edit |   |
| Antigenic Specificity | PPFIA3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PPFIA3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPFIA3. This antibody reacts with human. The PPFIA3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PPFIA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SSGHSTPRLAPPSPAREGTDKANHVPKEEAGAPRGEGPAIPGDTPPPTPRSARLERMTQALALQAGSLEDG |
| Other Names | KIAA0654liprin, liprin-alpha-3, LPNA3liprin-alpha 3, MGC126567, MGC126569, Protein tyrosine phosphatase receptor type f polypeptide-interacting proteinalpha-3, protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interactingprotein (liprin), alpha 3, protein tyrosine phosphatase, receptor type, f polypeptide, alpha 3, PTPRF-interacting protein alpha-3 |
| Gene, Accession # | PPFIA3, Gene ID: 8541, Accession: O75145, SwissProt: O75145 |
| Catalog # | NBP2-30453 |
| Price | |
| Order / More Info | PPFIA3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|