| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PPEF1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PPEF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPEF1. This antibody reacts with human. The PPEF1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PPEF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ILVIHGGISETTDLNLLHRVERNKMKSVLIPPTETNRDHDTDSKHNKVGVTFNAHGRIKTNGSPTEHLTEHEWEQIIDILWSDP |
|---|
| Other Names | EC 3.1.3.16, PP7, PPEF, PPEF-1, PPP7C, PPP7CA, protein phosphatase 7, catalytic subunit, alpha isozyme, Protein phosphatase with EF calcium-binding domain, protein phosphatase, EF-hand calcium binding domain 1, protein phosphatase, serine/threonine type, with EF-hands, serine/threonine protein phosphatase 7, Serine/threonine-protein phosphatase 7, serine/threonine-protein phosphatase with EF-hands 1 |
|---|
| Gene, Accession # | PPEF1, Gene ID: 5475 |
|---|
| Catalog # | NBP1-87239 |
|---|
| Price | |
|---|
| Order / More Info | PPEF1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|