| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PPDPF |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PPDPF Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPDPF. This antibody reacts with human. The PPDPF Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FGKSTLPFMATVLESAEHSEPPQASSSMTACGLARDAPRKQPGGQSSTAS |
|---|
| Other Names | C20orf149, chromosome 20 open reading frame 149, dJ697K14.9, Exocrine differentiation and proliferation factor, EXPDF, FLJ21046, MGC2479, pancreatic progenitor cell differentiation and proliferation factor, pancreatic progenitor cell differentiation and proliferation factor homolog(zebrafish) |
|---|
| Gene, Accession # | PPDPF, Gene ID: 79144 |
|---|
| Catalog # | NBP1-88304 |
|---|
| Price | |
|---|
| Order / More Info | PPDPF Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|