| 产品详情 |
| Edit |   |
| Antigenic Specificity | XRCC6BP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The XRCC6BP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to XRCC6BP1. This antibody reacts with human. The XRCC6BP1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human XRCC6BP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CEDCNGNVSGGFDASTSQIVLCQNNIHNQAHMNRVVTHELIHAFDHCRAHVDWFTNIRHLACSEVRAANLSGDCSLVNEI |
| Other Names | EC 3.4.24, EC 3.4.24.-, Ku70-binding protein 3, KUB3Ku70 binding protein 3, MGC134817, MGC134818, mitochondrial inner membrane protease ATP23 homolog, XRCC6 binding protein 1, XRCC6-binding protein 1 |
| Gene, Accession # | XRCC6BP1, Gene ID: 91419 |
| Catalog # | NBP1-81339 |
| Price | |
| Order / More Info | XRCC6BP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|