| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | XRCC6BP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The XRCC6BP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to XRCC6BP1. This antibody reacts with human. The XRCC6BP1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human XRCC6BP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EQLQQQHVSCQVFPERLAQGNPQQGFFSSFFTCNQKCQLRLLKTLETNPYVKLLLDAMKHSGCAVNKDRHF |
|---|
| Other Names | EC 3.4.24, EC 3.4.24.-, Ku70-binding protein 3, KUB3Ku70 binding protein 3, MGC134817, MGC134818, mitochondrial inner membrane protease ATP23 homolog, XRCC6 binding protein 1, XRCC6-binding protein 1 |
|---|
| Gene, Accession # | XRCC6BP1, Gene ID: 91419 |
|---|
| Catalog # | NBP2-58329 |
|---|
| Price | |
|---|
| Order / More Info | XRCC6BP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|