| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RREB1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RREB1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RREB1. This antibody reacts with human. The RREB1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human RREB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GSVPKAATTATPAATTSPKESSEPPAPASSPEAASPTEQGPAGTSKKRGRKRGMRSRPRANSGGVDLDSSGEFASIEKMLATTDTNKFSPF |
|---|
| Other Names | DNA-binding protein, FINB, Finger protein in nuclear bodies, hindsight homolog, HNT, LZ321, Raf-responsive zinc finger protein LZ321, ras responsive element binding protein 1, ras-responsive element-binding protein 1, RREB-1, Zep-1, zinc finger motif enhancer binding protein 1, Zinc finger motif enhancer-binding protein 1, zinc finger motif-enhancer binding-protein 1 |
|---|
| Gene, Accession # | RREB1, Gene ID: 6239 |
|---|
| Catalog # | NBP2-56824 |
|---|
| Price | |
|---|
| Order / More Info | RREB1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|