| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | OTUD7B/Cezanne/ZA20D1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The OTUD7B/Cezanne/ZA20D1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to OTUD7B/Cezanne/ZA20D1. This antibody reacts with human, mouse, rat. The OTUD7B/Cezanne/ZA20D1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat OTUD7B/Cezanne/ZA20D1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PHQDSIPSLEPGSHSKDGLHRGALLPPPYRVADSYSNGYREPPEPDGWAGGLRGLPPTQTKCKQPNCSFYG |
|---|
| Other Names | cellular zinc finger NF-kappaB Cezanne, Cellular zinc finger NF-kappa-B protein, CEZANNEA20 domain containing 1, EC 3.4.19.12, OTU domain containing 7B, OTU domain-containing protein 7B, ZA20D1, Zinc finger A20 domain-containing protein 1, Zinc finger protein Cezanne |
|---|
| Gene, Accession # | OTUD7B, Gene ID: 56957 |
|---|
| Catalog # | NBP1-88095 |
|---|
| Price | |
|---|
| Order / More Info | OTUD7B/Cezanne/ZA20D1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|