| Edit |   |
|---|
| Antigenic Specificity | OTUD6A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The OTUD6A Antibody from Novus Biologicals is a rabbit polyclonal antibody to OTUD6A. This antibody reacts with human. The OTUD6A Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human OTUD6A. Peptide sequence MEAEMAQKHRQELEKFQDDSSIESVVEDLAKMNLENRPPRSSKAHRKRER. |
|---|
| Other Names | DUBA2, DUBA-2, OTU domain containing 6A |
|---|
| Gene, Accession # | OTUD6A, Gene ID: 139562, Accession: NP_997203, SwissProt: NP_997203 |
|---|
| Catalog # | NBP1-91497 |
|---|
| Price | |
|---|
| Order / More Info | OTUD6A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|