| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Trim11 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Trim11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Trim11. This antibody reacts with human. The Trim11 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Trim11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KLEKSLEHLRKQMQDALLFQAQADETCVLWQKMVESQRQNVLGEFERLRRLLAEEEQQLLQRLEEEELEVLP |
|---|
| Other Names | BIA1, EC 6.3.2.-, Protein BIA1, RING finger protein 92, RNF92E3 ubiquitin-protein ligase TRIM11, tripartite motif containing 11, tripartite motif-containing 11, Tripartite motif-containing protein 11 |
|---|
| Gene, Accession # | TRIM11, Gene ID: 81559 |
|---|
| Catalog # | NBP2-55401 |
|---|
| Price | |
|---|
| Order / More Info | Trim11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|