| 产品详情 |
| Edit |   |
| Antigenic Specificity | Hexosaminidase A/HEXA |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Hexosaminidase A/HEXA Antibody from Novus Biologicals is a rabbit polyclonal antibody to Hexosaminidase A/HEXA. This antibody reacts with human, rat. The Hexosaminidase A/HEXA Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. This product is specific to Subunit or Isoform: alpha |
| Immunogen | Synthetic peptides corresponding to the C terminal of HEXA. Immunizing peptide sequence: WKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAV. |
| Other Names | beta-hexosaminidase subunit alpha, Beta-N-acetylhexosaminidase subunit alpha, EC 3.2.1, EC 3.2.1.52, hexosaminidase A (alpha polypeptide), Hexosaminidase subunit A, MGC99608, N-acetyl-beta-glucosaminidase subunit alpha, TSD |
| Gene, Accession # | HEXA, Gene ID: 3073, Accession: P06865, SwissProt: P06865 |
| Catalog # | NBP1-74127 |
| Price | |
| Order / More Info | Hexosaminidase A/HEXA Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 27466344 |
| 产品资料 |
|
|