| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MEK2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MEK2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MEK2. This antibody reacts with human. The MEK2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MEK2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEEL |
|---|
| Other Names | ERK activator kinase 2, MAPKK 2, MEK 2, MEK2EC 2.7.12.2, mitogen-activated protein kinase kinase 2, MKK2FLJ26075, p45, PRKMK2MAPKK2 |
|---|
| Gene, Accession # | MAP2K2, Gene ID: 5605, Accession: P36507, SwissProt: P36507 |
|---|
| Catalog # | NBP2-38660 |
|---|
| Price | |
|---|
| Order / More Info | MEK2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|