| 产品详情 |
| Edit |   |
| Antigenic Specificity | MEK1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 25408231). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MEK1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MEK1. This antibody reacts with human, rat. The MEK1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, rat MEK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQ |
| Other Names | dual specificity mitogen-activated protein kinase kinase 1, ERK activator kinase 1, MAP kinase kinase 1, MAPK/ERK kinase 1, MAPKK1, MEK1MAPKK 1, mitogen-activated protein kinase kinase 1, MKK1MEK 1, PRKMK1EC 2.7.12.2, protein kinase, mitogen-activated, kinase 1 (MAP kinase kinase 1) |
| Gene, Accession # | MAP2K1, Gene ID: 5604 |
| Catalog # | NBP1-87790 |
| Price | |
| Order / More Info | MEK1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 25408231 |
| 产品资料 |
|
|