| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ILF3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. In WB, antibody detects both full length 95 kDa protein and 76 kDa isoform. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ILF3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ILF3. This antibody reacts with human. The ILF3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to ILF3 (interleukin enhancer binding factor 3, 90kDa) The peptide sequence was selected from the N terminal of ILF3 (NP_004507). Peptide sequence PTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDD. |
|---|
| Other Names | Double-stranded RNA-binding protein 76, double-stranded RNA-binding protein, 76 kD, DRBF, DRBP76M-phase phosphoprotein 4, dsRNA binding protein NFAR-2/MPP4, interleukin enhancer binding factor 3, 90kDa, interleukin enhancer-binding factor 3, MPHOSPH4interleukin enhancer binding factor 3, 90kD, MPP4MMP4, NF90CBTF, NFAR-1, NFAR2, NFARNF110, NF-AT-90, Nuclear factor associated with dsRNA, Nuclear factor of activated T-cells 90 kDa, nuclear factor of activated T-cells, 90 kD, TCP110, TCP80, Translational control protein 80 |
|---|
| Gene, Accession # | ILF3, Gene ID: 3609, Accession: Q12906-2, SwissProt: Q12906-2 |
|---|
| Catalog # | NBP1-58225 |
|---|
| Price | |
|---|
| Order / More Info | ILF3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|