| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PKLR |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PKLR Antibody from Novus Biologicals is a rabbit polyclonal antibody to PKLR. This antibody reacts with human, mouse. The PKLR Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to PKLR(pyruvate kinase, liver and RBC) The peptide sequence was selected from the N terminal of PKLR (NP_870986). Peptide sequence STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE. |
|---|
| Other Names | EC 2.7.1.40, PK1PKRL, PKL, PKR, Pyruvate kinase 1, pyruvate kinase isozyme R/L, pyruvate kinase isozymes R/L, pyruvate kinase type L, pyruvate kinase, liver and blood cell, pyruvate kinase, liver and RBC, Red cell/liver pyruvate kinase, RPK, R-type/L-type pyruvate kinase |
|---|
| Gene, Accession # | PKLR, Gene ID: 5313, Accession: P30613-2, SwissProt: P30613-2 |
|---|
| Catalog # | NBP1-56319 |
|---|
| Price | |
|---|
| Order / More Info | PKLR Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22367961 |
|---|
| 产品资料 |
|
|