| Edit |   |
| Antigenic Specificity | HSPA12A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The HSPA12A Antibody from Novus Biologicals is a rabbit polyclonal antibody to HSPA12A. This antibody reacts with human. The HSPA12A Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human HSPA12A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MADKEAGGSDGPRETAPTSAYSSPARSLGDTGITPLSPSHIVNDTDSNVSEQQSFLVVVAV |
| Other Names | FLJ13874, heat shock 70 kDa protein 12A, heat shock 70kD protein 12A, heat shock 70kDa protein 12A, KIAA0417 |
| Gene, Accession # | HSPA12A, Gene ID: 259217 |
| Catalog # | NBP2-57850 |
| Price | |
| Order / More Info | HSPA12A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |