| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | XPD |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The XPD Antibody from Novus Biologicals is a rabbit polyclonal antibody to XPD. This antibody reacts with human. The XPD Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human XPD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLK |
|---|
| Other Names | Basic transcription factor 2 80 kDa subunit, BTF2 p80, COFS2, CXPD, DNA excision repair protein ERCC-2, DNA repair protein complementing XP-D cells, EC 3.6.1, EC 3.6.4.12, EM9TFIIH basal transcription factor complex 80 kDa subunit, excision repair cross-complementing rodent repair deficiency, complementationgroup 2, MAG, MGC102762, MGC126218, MGC126219, TFIIH 80 kDa subunit, TFIIH basal transcription factor complex helicase subunit, TFIIH basal transcription factor complex helicase XPD subunit, TTD, xeroderma pigmentosum complementary group D, Xeroderma pigmentosum group D-complementing protein, XPDC, XPDTFIIH p80 |
|---|
| Gene, Accession # | ERCC2, Gene ID: 2068 |
|---|
| Catalog # | NBP2-56327 |
|---|
| Price | |
|---|
| Order / More Info | XPD Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|