| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Transglutaminase 2/TGM2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Transglutaminase 2/TGM2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Transglutaminase 2/TGM2. This antibody reacts with human. The Transglutaminase 2/TGM2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Transglutaminase 2/TGM2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQEAGTK |
|---|
| Other Names | C polypeptide, EC 2.3.2.13, G-ALPHA-h, protein-glutamine gamma-glutamyltransferase 2, protein-glutamine-gamma-glutamyltransferase, TG(C), TG2, TGase C, TGase H, TGase-2, TGase-H, TGCGNAH, Tissue transglutaminase, transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase), Transglutaminase C, Transglutaminase H, Transglutaminase-2 |
|---|
| Gene, Accession # | TGM2, Gene ID: 7052 |
|---|
| Catalog # | NBP1-86952 |
|---|
| Price | |
|---|
| Order / More Info | Transglutaminase 2/TGM2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|