| Edit |   |
| Antigenic Specificity | SNX7 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SNX7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SNX7. This antibody reacts with human. The SNX7 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to SNX7(sorting nexin 7) The peptide sequence was selected from the middle region of SNX7. Peptide sequence LDSKVEVLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQND. |
| Other Names | DKFZp564F052, MGC8717, sorting nexin 7, sorting nexin-7 |
| Gene, Accession # | SNX7, Gene ID: 51375, Accession: Q9UNH6, SwissProt: Q9UNH6 |
| Catalog # | NBP1-58862 |
| Price | |
| Order / More Info | SNX7 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |