| Edit |   |
|---|
| Antigenic Specificity | SNX5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SNX5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SNX5. This antibody reacts with human. The SNX5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SNX5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FFEQEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRV |
|---|
| Other Names | FLJ10931, sorting nexin 5, sorting nexin-5 |
|---|
| Gene, Accession # | SNX5, Gene ID: 27131, Accession: Q9Y5X3, SwissProt: Q9Y5X3 |
|---|
| Catalog # | NBP2-38641 |
|---|
| Price | |
|---|
| Order / More Info | SNX5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|