| Edit |   |
|---|
| Antigenic Specificity | Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1. This antibody reacts with human. The Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to HS3ST1(heparan sulfate (glucosamine) 3-O-sulfotransferase 1) The peptide sequence was selected from the middle region of HS3ST1. Peptide sequence TKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV. |
|---|
| Other Names | 3OST, 3-OST-1, 3OST1Heparan sulfate 3-O-sulfotransferase 1, EC 2.8.2, EC 2.8.2.23, h3-OST-1, heparan sulfate (glucosamine) 3-O-sulfotransferase 1, Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 1, heparan sulfate glucosamine 3-O-sulfotransferase 1, heparin-glucosamine 3-O-sulfotransferase |
|---|
| Gene, Accession # | HS3ST1, Gene ID: 9957, Accession: O14792, SwissProt: O14792 |
|---|
| Catalog # | NBP1-58058 |
|---|
| Price | |
|---|
| Order / More Info | Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|