| Edit |   |
| Antigenic Specificity | Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1. This antibody reacts with human. The Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human HS2ST1 (NP_036394). Peptide sequence GLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVR. |
| Other Names | 2OST, 2-O-sulfotransferase, EC 2.8.2, EC 2.8.2.-, FLJ11317, heparan sulfate 2-O-sulfotransferase 1, HS2ST, KIAA0448dJ604K5.2, MGC131986 |
| Gene, Accession # | HS2ST1, Gene ID: 9653, Accession: Q7LGA3, SwissProt: Q7LGA3 |
| Catalog # | NBP1-79293 |
| Price | |
| Order / More Info | Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |